PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 786aa    MW: 86900.7 Da    PI: 6.1864
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089885.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.32.9e-23181282199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + + 
  XP_011089885.1 181 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGEA 272
                     99****************************86333.45679************************************************..3488 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     + l+++++r+
  XP_011089885.1 273 GDLRLGIRRA 282
                     8899999986 PP

2Auxin_resp112.73.4e-37307388182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +a+a+s++s+F v+Y+Pras+++F+v+++k++k +++++ vG+Rfkm+f+ +ds+err+sG+v+gv d+dp+rWpnSkWr+L
  XP_011089885.1 307 VANALSSNSTFPVFYSPRASHADFIVPYQKYVKCTTSQIPVGTRFKMRFDFDDSPERRFSGVVTGVGDMDPYRWPNSKWRCL 388
                     689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.97E-44172293IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.8E-40174294IPR015300DNA-binding pseudobarrel domain
CDDcd100175.78E-22179281No hitNo description
SMARTSM010199.7E-23181283IPR003340B3 DNA binding domain
PfamPF023623.7E-21181282IPR003340B3 DNA binding domain
PROSITE profilePS5086312.957181283IPR003340B3 DNA binding domain
PfamPF065073.7E-31307388IPR010525Auxin response factor
PROSITE profilePS5174520.908658740IPR000270PB1 domain
SuperFamilySSF542772.35E-11660737No hitNo description
PfamPF023093.4E-5706743IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MEIDLNHAVC EVENSNNASG NGEECDKGEG GSCVYGCLST STSSCSSNAA FDSSSPSSVP  60
APSSSIYMEL WHACAGPLTT LPRKGNVVVY FPQGHLEQAA SASPFPPMEM PTFDLPPQIF  120
CRVVDVQLLA NKENDEVYTQ LSLLPLSELV GLKLEGKESE NAGADEDGNG VVPAKSTSHM  180
FCKTLTASDT STHGGFSVPR RAAEDCFPPL DYKEQRPSQE LIAKDLHGVE WKFRHIYRGQ  240
PRRHLLTTGW SIFVSQKNLV SGDAVLFLRG EAGDLRLGIR RAARPRNGLP DSIIKNQNSY  300
PNVLSPVANA LSSNSTFPVF YSPRASHADF IVPYQKYVKC TTSQIPVGTR FKMRFDFDDS  360
PERRFSGVVT GVGDMDPYRW PNSKWRCLMV RWNEDIMSNH QERVSPWDID FSGGAALLDF  420
EESVRSSKVL QGQENVGLAP PLYRSDRINR QLDFETRPPP PNPVPNRMEK INYGEFVRNQ  480
GSATFTGFLE SNWFPKVLQG QEICSLRSLA GKTDSSLGAW SKPSLGYNLH NMHQRPTPSF  540
YPLASEGARN MPIPHNGIYR VGQGPSVLSN FSNFRMGNHA LTPTSILSGA AADIGRAPHL  600
TIEPRAQEKT SAPTTSTMHF KNMNNDDNLK EKVPICKIFG FSLTEDPTNL SLQGPSKRSC  660
TKVHKQGSLV GRAIDLSRLH GYDDLLVELE RLFSMEGLLR DPNNGWRILY TDSENDMMVV  720
GDDPWHEFVE VVTKIHIYTQ EEVEKLTIGI NSDDTKSCLE EAPPAPDVSK SSSVGQPDSS  780
PTVIRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1216341016353Auxin response factor 1
4ldw_A1e-1216341016353Auxin response factor 1
4ldv_A1e-1216341016353Auxin response factor 1
4ldx_B1e-1216341016353Auxin response factor 1
4ldx_A1e-1216341016353Auxin response factor 1
4ldy_B1e-1216341016353Auxin response factor 1
4ldy_A1e-1216341016353Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089885.10.0PREDICTED: auxin response factor 4 isoform X3
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLQ2LAI90.0Q2LAI9_SOLLC; Auxin response factor
STRINGSolyc11g069190.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4